R&D Starts Here

FITC Beta-Amyloid (1-40)

Price range: $260.00 through $405.00

  • Physical State: White lyophilized powder
  • Temperature Storage: -20°C
  • Temperature Shipping: Ambient
  • Sequence:
    DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
  • Source: Recombinant. A DNA sequence encoding the human Beta-Amyloid (1-40) sequence was expressed in E. coli and had FITC molecules attached for fluorescence.
  • Purity: >95% by Mass Spec.
  • Molecular Mass: Approximately 4,330 Da to 5,108 Da
SKU: N/A Category:

Description

FITC Beta-Amyloid (1-40)

Product background: Beta-Amyloid peptides (A-beta), the major constituent of amyloid plaques in the brains of Alzheimer’s patients, are thought to be a primary contributor to Alzheimer’s Disease (AD).

About the product: Expressed recombinantly in E. coli, Beta-Amyloid (1-40) is purified to our highest standards to ensure batch-to-batch consistency in both purity and quality. rPeptide’s human Beta-Amyloid has been covalently labeled with Fluorescein Isothiocyanate on the side chain of lysine residues.  FITC Beta-Amyloid (1-40)

Applications: This FITC labeled form of Beta-Amyloid (1-40) is ideally suited to localization experiments, aggregation monitoring and other fluorescence based studies without the need for mutations or further labeling.

Additional information

Size

0.5 mg, 1.0 mg